PDB entry 1z7e

View 1z7e on RCSB PDB site
Description: Crystal structure of full length ArnA
Class: hydrolase
Keywords: Rossmann fold; OB-like fold, HYDROLASE
Deposited on 2005-03-24, released 2005-06-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein ArnA
    Species: Escherichia coli [TaxId:562]
    Gene: PmrI, yfbG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1z7ea1, d1z7ea2, d1z7ea3
  • Chain 'B':
    Compound: protein ArnA
    Species: Escherichia coli [TaxId:562]
    Gene: PmrI, yfbG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1z7eb1, d1z7eb2, d1z7eb3
  • Chain 'C':
    Compound: protein ArnA
    Species: Escherichia coli [TaxId:562]
    Gene: PmrI, yfbG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1z7ec1, d1z7ec2, d1z7ec3
  • Chain 'D':
    Compound: protein ArnA
    Species: Escherichia coli [TaxId:562]
    Gene: PmrI, yfbG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1z7ed1, d1z7ed2, d1z7ed3
  • Chain 'E':
    Compound: protein ArnA
    Species: Escherichia coli [TaxId:562]
    Gene: PmrI, yfbG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1z7ee1, d1z7ee2, d1z7ee3
  • Chain 'F':
    Compound: protein ArnA
    Species: Escherichia coli [TaxId:562]
    Gene: PmrI, yfbG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1z7ef1, d1z7ef2, d1z7ef3
  • Heterogens: ATP, UGA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z7eA (A:)
    mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
    nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
    lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
    khgnileiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkf
    tvwssrvhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvq
    gsrlnsqpactarrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhp
    hfhfvegdisihsewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriiryc
    vkyrkriifpstsevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygek
    eglqftlfrpfnwmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdi
    rdgiealyriienagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagf
    rvvesssyygkgyqdvehrkpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7eA (A:)
    mktvvfayhdmgclgieallaagyeisaifthtdgsvarlaaergipvyapdnvnhplwv
    eriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvngetet
    gvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnilei
    aqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvh
    phaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrlrrtr
    vlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihsewie
    yhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstsevyg
    mcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwmgpr
    ldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriienagnr
    cdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgyqdve
    hrkpsirnahrcldwepkidmqetidetldfflrtvdlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z7eB (B:)
    mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
    nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
    lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
    khgnileiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkf
    tvwssrvhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvq
    gsrlnsqpactarrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhp
    hfhfvegdisihsewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriiryc
    vkyrkriifpstsevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygek
    eglqftlfrpfnwmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdi
    rdgiealyriienagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagf
    rvvesssyygkgyqdvehrkpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7eB (B:)
    mktvvfayhdmgclgieallaagyeisaifthtdgsvarlaaergipvyapdnvnhplwv
    eriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvngetet
    gvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnilei
    aqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvh
    phaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrlrrtr
    vlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihsewie
    yhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstsevyg
    mcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwmgpr
    ldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriienagnr
    cdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgyqdve
    hrkpsirnahrcldwepkidmqetidetldfflrtvdlt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z7eC (C:)
    mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
    nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
    lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
    khgnileiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkf
    tvwssrvhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvq
    gsrlnsqpactarrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhp
    hfhfvegdisihsewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriiryc
    vkyrkriifpstsevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygek
    eglqftlfrpfnwmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdi
    rdgiealyriienagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagf
    rvvesssyygkgyqdvehrkpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7eC (C:)
    mktvvfayhdmgclgieallaagyeisaifthtdgsvarlaaergipvyapdnvnhplwv
    eriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvngetet
    gvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnilei
    aqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvh
    phaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrlrrtr
    vlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihsewie
    yhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstsevyg
    mcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwmgpr
    ldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriienagnr
    cdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgyqdve
    hrkpsirnahrcldwepkidmqetidetldfflrtvdlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z7eD (D:)
    mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
    nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
    lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
    khgnileiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkf
    tvwssrvhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvq
    gsrlnsqpactarrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhp
    hfhfvegdisihsewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriiryc
    vkyrkriifpstsevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygek
    eglqftlfrpfnwmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdi
    rdgiealyriienagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagf
    rvvesssyygkgyqdvehrkpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7eD (D:)
    mktvvfayhdmgclgieallaagyeisaifthtdgsvarlaaergipvyapdnvnhplwv
    eriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvngetet
    gvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnilei
    aqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvh
    phaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrlnsqp
    rrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisih
    sewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpst
    sevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfn
    wmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriie
    nagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkg
    yqdvehrkpsirnahrcldwepkidmqetidetldfflrtvdlt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z7eE (E:)
    mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
    nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
    lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
    khgnileiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkf
    tvwssrvhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvq
    gsrlnsqpactarrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhp
    hfhfvegdisihsewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriiryc
    vkyrkriifpstsevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygek
    eglqftlfrpfnwmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdi
    rdgiealyriienagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagf
    rvvesssyygkgyqdvehrkpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7eE (E:)
    mktvvfayhdmgclgieallaagyeisaifthtdgsvarlaaergipvyapdnvnhplwv
    eriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvngetet
    gvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnilei
    aqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvh
    phaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrlrrtr
    vlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihsewie
    yhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstsevyg
    mcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwmgpr
    ldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriienagnr
    cdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgyqdve
    hrkpsirnahrcldwepkidmqetidetldfflrtvdlt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z7eF (F:)
    mktvvfayhdmgclgieallaagyeisaifthtdnpgekafygsvarlaaergipvyapd
    nvnhplwveriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwv
    lvngetetgvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpai
    khgnileiaqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkf
    tvwssrvhphaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvq
    gsrlnsqpactarrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhp
    hfhfvegdisihsewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriiryc
    vkyrkriifpstsevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygek
    eglqftlfrpfnwmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdi
    rdgiealyriienagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagf
    rvvesssyygkgyqdvehrkpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7eF (F:)
    mktvvfayhdmgclgieallaagyeisaifthtdgsvarlaaergipvyapdnvnhplwv
    eriaqlspdvifsfyyrhliydeilqlapagafnlhgsllpkyrgraplnwvlvngetet
    gvtlhrmvkradagaivaqlriaiapddiaitlhhklchaarqlleqtlpaikhgnilei
    aqreneatcfgrrtpddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvh
    phaskaqpgsvisvaplliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrlrrtr
    vlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihsewie
    yhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstsevyg
    mcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwmgpr
    ldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriienagnr
    cdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgyqdve
    hrkpsirnahrcldwepkidmqetidetldfflrtvdlt