PDB entry 1z7d

View 1z7d on RCSB PDB site
Description: Ornithine aminotransferase PY00104 from Plasmodium Yoelii
Class: transferase
Keywords: Structural Genomics Consortium, SGC, malaria, plasmodium yoelii, ornithine aminotransferase
Deposited on 2005-03-24, released 2005-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine aminotransferase
    Species: Plasmodium yoelii [TaxId:73239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7da1
  • Chain 'B':
    Compound: ornithine aminotransferase
    Species: Plasmodium yoelii [TaxId:73239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7db_
  • Chain 'C':
    Compound: ornithine aminotransferase
    Species: Plasmodium yoelii [TaxId:73239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7dc_
  • Chain 'D':
    Compound: ornithine aminotransferase
    Species: Plasmodium yoelii [TaxId:73239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7dd_
  • Chain 'E':
    Compound: ornithine aminotransferase
    Species: Plasmodium yoelii [TaxId:73239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7de_
  • Chain 'F':
    Compound: ornithine aminotransferase
    Species: Plasmodium yoelii [TaxId:73239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7df_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z7dA (A:)
    mgsshhhhhhssglvprgsmefvkdlktpedyinnelkygahnydpipvvlkrakgvfvy
    dvndkryydflsayssvnqghchpnilnaminqaknlticsraffsvplgiceryltnll
    gydkvlmmntgaeanetayklcrkwgyevkkipenmakivvcknnfsgrtlgcisasttk
    kctsnfgpfapqfskvpyddlealeeelkdpnvcafivepiqgeagvivpsdnylqgvyd
    ickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisavlanddim
    lvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrelkdskivr
    dvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitkeqldecte
    iivktvkffderf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7dA (A:)
    ktpedyinnelkygahnydpipvvlkrakgvfvydvndkryydflsayssvnqghchpni
    lnaminqaknlticsraffsvplgiceryltnllgydkvlmmntgaeanetayklcrkwg
    yevkkipenmakivvcknnqfskvpyddlealeeelkdpnvcafivepiqgeagvivpsd
    nylqgvydickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisa
    vlanddimlvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkre
    lkdskivrdvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitk
    eqldecteiivktvkffd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z7dB (B:)
    mgsshhhhhhssglvprgsmefvkdlktpedyinnelkygahnydpipvvlkrakgvfvy
    dvndkryydflsayssvnqghchpnilnaminqaknlticsraffsvplgiceryltnll
    gydkvlmmntgaeanetayklcrkwgyevkkipenmakivvcknnfsgrtlgcisasttk
    kctsnfgpfapqfskvpyddlealeeelkdpnvcafivepiqgeagvivpsdnylqgvyd
    ickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisavlanddim
    lvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrelkdskivr
    dvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitkeqldecte
    iivktvkffderf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7dB (B:)
    ktpedyinnelkygahnydpipvvlkrakgvfvydvndkryydflsayssvnqghchpni
    lnaminqaknlticsraffsvplgiceryltnllgydkvlmmntgaeanetayklcrkwg
    yevkkipenmakivvcknnfskvpyddlealeeelkdpnvcafivepiqgeagvivpsdn
    ylqgvydickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisav
    landdimlvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrel
    kdskivrdvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitke
    qldecteiivktvkffd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z7dC (C:)
    mgsshhhhhhssglvprgsmefvkdlktpedyinnelkygahnydpipvvlkrakgvfvy
    dvndkryydflsayssvnqghchpnilnaminqaknlticsraffsvplgiceryltnll
    gydkvlmmntgaeanetayklcrkwgyevkkipenmakivvcknnfsgrtlgcisasttk
    kctsnfgpfapqfskvpyddlealeeelkdpnvcafivepiqgeagvivpsdnylqgvyd
    ickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisavlanddim
    lvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrelkdskivr
    dvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitkeqldecte
    iivktvkffderf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7dC (C:)
    ktpedyinnelkygahnydpipvvlkrakgvfvydvndkryydflsayssvnqghchpni
    lnaminqaknlticsraffsvplgiceryltnllgydkvlmmntgaeanetayklcrkwg
    yevkkipenmakivvcyddlealeeelkdpnvcafivepiqgeagvivpsdnylqgvydi
    ckkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisavlanddiml
    vikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrelkdskivrd
    vrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitkeqldectei
    ivktvkffd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z7dD (D:)
    mgsshhhhhhssglvprgsmefvkdlktpedyinnelkygahnydpipvvlkrakgvfvy
    dvndkryydflsayssvnqghchpnilnaminqaknlticsraffsvplgiceryltnll
    gydkvlmmntgaeanetayklcrkwgyevkkipenmakivvcknnfsgrtlgcisasttk
    kctsnfgpfapqfskvpyddlealeeelkdpnvcafivepiqgeagvivpsdnylqgvyd
    ickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisavlanddim
    lvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrelkdskivr
    dvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitkeqldecte
    iivktvkffderf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7dD (D:)
    ktpedyinnelkygahnydpipvvlkrakgvfvydvndkryydflsayssvnqghchpni
    lnaminqaknlticsraffsvplgiceryltnllgydkvlmmntgaeanetayklcrkwg
    yevkkipenmakivvckfskvpyddlealeeelkdpnvcafivepiqgeagvivpsdnyl
    qgvydickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisavla
    nddimlvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrelkd
    skivrdvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitkeql
    decteiivktvkffd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z7dE (E:)
    mgsshhhhhhssglvprgsmefvkdlktpedyinnelkygahnydpipvvlkrakgvfvy
    dvndkryydflsayssvnqghchpnilnaminqaknlticsraffsvplgiceryltnll
    gydkvlmmntgaeanetayklcrkwgyevkkipenmakivvcknnfsgrtlgcisasttk
    kctsnfgpfapqfskvpyddlealeeelkdpnvcafivepiqgeagvivpsdnylqgvyd
    ickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisavlanddim
    lvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrelkdskivr
    dvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitkeqldecte
    iivktvkffderf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7dE (E:)
    ktpedyinnelkygahnydpipvvlkrakgvfvydvndkryydflsayssvnqghchpni
    lnaminqaknlticsraffsvplgiceryltnllgydkvlmmntgaeanetayklcrkwg
    yevkkipenmakivvcfskvpyddlealeeelkdpnvcafivepiqgeagvivpsdnylq
    gvydickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisavlan
    ddimlvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrelkds
    kivrdvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitkeqld
    ecteiivktvkffd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z7dF (F:)
    mgsshhhhhhssglvprgsmefvkdlktpedyinnelkygahnydpipvvlkrakgvfvy
    dvndkryydflsayssvnqghchpnilnaminqaknlticsraffsvplgiceryltnll
    gydkvlmmntgaeanetayklcrkwgyevkkipenmakivvcknnfsgrtlgcisasttk
    kctsnfgpfapqfskvpyddlealeeelkdpnvcafivepiqgeagvivpsdnylqgvyd
    ickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisavlanddim
    lvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrelkdskivr
    dvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitkeqldecte
    iivktvkffderf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7dF (F:)
    ktpedyinnelkygahnydpipvvlkrakgvfvydvndkryydflsayssvnqghchpni
    lnaminqaknlticsraffsvplgiceryltnllgydkvlmmntgaeanetayklcrkwg
    yevkkipenmakivvckfskvpyddlealeeelkdpnvcafivepiqgeagvivpsdnyl
    qgvydickkynvlfvadevqtglgrtgkllcvhhynvkpdvillgkalsgghypisavla
    nddimlvikpgehgstyggnplaasicvealnvlineklcenaeklggpflenlkrelkd
    skivrdvrgkgllcaiefknelvnvldiclklkenglitrdvhdktirltpplcitkeql
    decteiivktvkffd