PDB entry 1z7c

View 1z7c on RCSB PDB site
Description: Crystal Structure of Human Placental Lactogen
Class: hormone/growth factor
Keywords: four-helix bundle protein, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2005-03-24, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.233
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chorionic somatomammotropin hormone
    Species: Homo sapiens [TaxId:9606]
    Gene: CSH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z7ca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z7cA (A:)
    vqtvplsrlfdhamlqahrahqlaidtyqefeetyipkdqkysflhdsqtsfcfsdsipt
    psnmeetqqksnlellrislllieswlepvrflrsmfannlvydtsdsddyhllkdleeg
    iqtlmgrledgsrrtgqilkqtyskfdtnshnhdallknygllycfrkdmdkvetflrmv
    qcrsvegscgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7cA (A:)
    qtvplsrlfdhamlqahrahqlaidtyqefeetyipkdqkysflsfcfsdsiptsnlell
    rislllieswlepvrflrsmfannlvydtsdsddyhllkdleegiqtlmgrleqilkqty
    skfdtdallknygllycfrkdmdkvetflrmvqcrsvegsc