PDB entry 1z7b

View 1z7b on RCSB PDB site
Description: Crystal structure of E.coli ArnA dehydrogenase (decarboxylase) domain, R619E mutant
Class: hydrolase
Keywords: Rossmann fold
Deposited on 2005-03-24, released 2005-06-07
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.2
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein ArnA
    Species: Escherichia coli
    Gene: PmrI, yfbG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77398
      • engineered (316)
    Domains in SCOP 1.75: d1z7ba1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z7bA (A:)
    hgmsqpactarrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphf
    hfvegdisihsewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvk
    yrkriifpstsevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeg
    lqftlfrpfnwmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdird
    giealyriienagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrv
    vesssyygkgyqdvehekpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z7bA (A:)
    rtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihse
    wieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstse
    vygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwm
    gprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriiena
    gnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesqdvehekps
    irnahrcldwepkidmqetidetldfflrtvdlt