PDB entry 1z78

View 1z78 on RCSB PDB site
Description: Crystal Structure of the Thrombospondin-1 N-terminal domain
Class: cell adhesion
Keywords: tsp-1, ntsp-1, cell adhesion
Deposited on 2005-03-24, released 2006-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.236
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombospondin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: THBS1, TSP, TSP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z78a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z78A (A:)
    nripesggdnsvfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdl
    vdavrtekgflllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkq
    hvvsveeallatgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlr
    iakggvndnfqgvlqnvrfvfgttpedilrnkgcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z78A (A:)
    nsvfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrtekg
    flllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsveeal
    latgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggvndn
    fqgvlqnvrfvfgttpedilrnkgcs