PDB entry 1z77

View 1z77 on RCSB PDB site
Description: Crystal structure of transcriptional regulator protein from Thermotoga maritima.
Class: transcription
Keywords: transcriptional regulator, TetR family, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-03-24, released 2005-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator (TetR family)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0C0 (0-199)
      • modified residue (0)
      • modified residue (55)
      • modified residue (70)
      • modified residue (81)
      • modified residue (154)
      • modified residue (179)
      • modified residue (189)
      • modified residue (197)
    Domains in SCOPe 2.06: d1z77a1, d1z77a2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z77A (A:)
    mlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvte
    klqkefenflmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilld
    leksqrvffdfvreklkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdm
    ntlveevkvmlrilkkgmtk