PDB entry 1z76

View 1z76 on RCSB PDB site
Description: Crystal structure of an acidic phospholipase A2 (BthA-I) from Bothrops jararacussu venom complexed with p-bromophenacyl bromide
Class: hydrolase
Keywords: X-ray crystallography, acidic phospholipase A2, Bothrops jararacussu venom, platelet aggregation and hypotensive effects, crystal structure, oligomeric state, dimeric phospholipase A2, phospholipase A2 inhibition, p-bromophenacyl bromide, HYDROLASE
Deposited on 2005-03-24, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed):
    • GB AAN37410 (0-121)
    Domains in SCOPe 2.07: d1z76a_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed):
    • GB AAN37410 (0-121)
    Domains in SCOPe 2.07: d1z76b_
  • Heterogens: PBP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z76A (A:)
    slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
    idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
    pc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z76B (B:)
    slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
    idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
    pc