PDB entry 1z75

View 1z75 on RCSB PDB site
Description: Crystal Structure of ArnA dehydrogenase (decarboxylase) domain, R619M mutant
Class: hydrolase
Keywords: Rossmann fold, HYDROLASE
Deposited on 2005-03-24, released 2005-06-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein ArnA
    Species: Escherichia coli [TaxId:562]
    Gene: PmrI, yfbG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77398
      • engineered (316)
    Domains in SCOPe 2.01: d1z75a1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z75A (A:)
    hgmsqpactarrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphf
    hfvegdisihsewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvk
    yrkriifpstsevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeg
    lqftlfrpfnwmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdird
    giealyriienagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrv
    vesssyygkgyqdvehmkpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z75A (A:)
    rtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihse
    wieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstse
    vygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwm
    gprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriiena
    gnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesqdvehmkps
    irnahrcldwepkidmqetidetldfflrtvdlt