PDB entry 1z73

View 1z73 on RCSB PDB site
Description: Crystal Structure of E. coli ArnA dehydrogenase (decarboxylase) domain, S433A mutant
Class: hydrolase
Keywords: Rossmann fold
Deposited on 2005-03-24, released 2005-06-07
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein ArnA
    Species: Escherichia coli
    Gene: PmrI, yfbG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77398
      • engineered (130)
    Domains in SCOP 1.75: d1z73a1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z73A (A:)
    hgmsqpactarrrtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphf
    hfvegdisihsewieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvk
    yrkriifpstaevygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeg
    lqftlfrpfnwmgprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdird
    giealyriienagnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrv
    vesssyygkgyqdvehrkpsirnahrcldwepkidmqetidetldfflrtvdltdkps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z73A (A:)
    rtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihse
    wieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstae
    vygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwm
    gprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriiena
    gnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesvehrkpsir
    nahrcldwepkidmqetidetldfflrtvdlt