PDB entry 1z72

View 1z72 on RCSB PDB site
Description: Structure of a putative transcriptional regulator from Streptococcus pneumoniae
Class: Transcription Regulator
Keywords: Streptococcus pneumoniae, transcriptional regulator, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Transcription Regulator
Deposited on 2005-03-23, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.152
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, putative
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP0716
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97RS7
      • modified residue (66)
      • modified residue (128)
      • modified residue (143)
    Domains in SCOPe 2.07: d1z72a_
  • Chain 'B':
    Compound: Transcriptional regulator, putative
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: SP0716
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97RS7
      • modified residue (66)
      • modified residue (128)
      • modified residue (143)
    Domains in SCOPe 2.07: d1z72b_
  • Heterogens: MG, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z72A (A:)
    snametqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhf
    fdaflsmlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhp
    vtkafqdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpff
    aewvqflvdelnrvgknredltelqqrwnqavalelaffdigydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z72A (A:)
    qdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafls
    mlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkafq
    dlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvqf
    lvdelnrvgkredltelqqrwnqavalelaffdigy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z72B (B:)
    snametqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhf
    fdaflsmlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhp
    vtkafqdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpff
    aewvqflvdelnrvgknredltelqqrwnqavalelaffdigydv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z72B (B:)
    tqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafl
    smlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkaf
    qdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvq
    flvdelnrvgkrltelqqrwnqavalelaffdigy