PDB entry 1z71

View 1z71 on RCSB PDB site
Description: thrombin and P2 pyridine N-oxide inhibitor complex structure
Class: hydrolase/hydrolase inhibitor
Keywords: thrombin inhibitor complex, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2005-03-23, released 2005-05-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1z71a_
  • Chain 'B':
    Compound: Hirudin IIIB'
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28511 (0-10)
      • see remark 999 (10)
  • Heterogens: L17, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z71A (A:)
    dcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcgas
    lisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpryn
    wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtan
    vgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvm
    kspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z71A (A:)
    dcglrplfekksledkterellesyiivegsdaeigmspwqvmlfrkspqellcgaslis
    drwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynwre
    nldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlkegqpsvlqv
    vnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqm
    givswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

  • Chain 'B':
    No sequence available.