PDB entry 1z70

View 1z70 on RCSB PDB site
Description: 1.15A resolution structure of the formylglycine generating enzyme FGE
Class: oxidoreductase
Keywords: Formylglycine, multiple sulfatase deficiency, cysteine sulfenic acid, OXIDOREDUCTASE
Deposited on 2005-03-23, released 2005-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.139
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: C-alpha-formyglycine-generating enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAO34683
      • modified residue (263)
      • modified residue (268)
    Domains in SCOPe 2.07: d1z70x_
  • Heterogens: CA, CL, CXS, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1z70X (X:)
    eanapgpvpgerqlahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevs
    ntefekfvnstgylteaekfgdsfvfegmlseqvktniqqavaaapwwlpvkganwrhpe
    gpdstilhrpdhpvlhvswndavayctwagkrlpteaeweyscrgglhnrlfpwgnklqp
    kgqhyaniwqgefpvtntgedgfqgtapvdafppngyglynivgnawewtsdwwtvhhsv
    eetlnpkgppsgkdrvkkggsymchrsycyryrcaarsqntpdssasnlgfrcaadrlpt
    mdrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z70X (X:)
    lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgy
    lteaekfgdsfvfegmlsvaaapwwlpvkganwrhpegpdstilhrpdhpvlhvswndav
    ayctwagkrlpteaeweyscrgglhnrlfpwgnklqpkgqhyaniwqgefpvtntgedgf
    qgtapvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgkdrvkkggsym
    chrsycyryrcaarsqntpdssasnlgfrcaadrlp