PDB entry 1z6y

View 1z6y on RCSB PDB site
Description: Structure Of Human ADP-Ribosylation Factor-Like 5
Class: transport protein
Keywords: GDP-Binding, Membrane Trafficking, Structural Genomics, Structural Genomics Consortium, SGC, TRANSPORT PROTEIN
Deposited on 2005-03-23, released 2005-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.235
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: ARL5, ARFLP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z6ya_
  • Chain 'B':
    Compound: ADP-ribosylation factor-like protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: ARL5, ARFLP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z6yb_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6yA (A:)
    mgilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinnt
    rflmwdiggqeslrsswntyytntefvivvvdstdrerisvtreelykmlahedlrkagl
    lifankqdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsrlkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6yA (A:)
    ilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntrf
    lmwdiggqeslrsyytntefvivvvdstdrerisvtreelykmlahedlrkagllifank
    qdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z6yB (B:)
    mgilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinnt
    rflmwdiggqeslrsswntyytntefvivvvdstdrerisvtreelykmlahedlrkagl
    lifankqdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsrlkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6yB (B:)
    ilftriwrlfnhqehkviivgldnagkttilyqfsmnevvhtsptigsnveeivinntrf
    lmwdiggqeslrsyytntefvivvvdstdrerisvtreelykmlahedlrkagllifank
    qdvkecmtvaeisqflkltsikdhqwhiqaccaltgeglcqglewmmsr