PDB entry 1z6u

View 1z6u on RCSB PDB site
Description: np95-like ring finger protein isoform b [homo sapiens]
Deposited on 2005-03-23, released 2005-05-03
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Np95-like ring finger protein isoform b
    Species: Homo sapiens [TaxId:9606]
    Gene: UHRF2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Np95-like ring finger protein isoform b
    Species: Homo sapiens [TaxId:9606]
    Gene: UHRF2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z6uA (A:)
    mgsshhhhhhssglvprgspsaskvykasdsaeaieafqltpqqqhliredcqnqklwde
    vlshlvegpnflkkleqsfmcvccqelvyqpvttecfhnvckdclqrsfkaqvfscpacr
    hdlgqnyimipneilqtlldlffpgyskgr
    

    Sequence, based on observed residues (ATOM records):
    >1z6uA (A:)
    eafqltpqqqhliredcqnqklwdevlshlvegpnflkkleqsfmcvccqelvyqpvtte
    cfhnvckdclqrsfkaqvfscpacrhdlgqnyimipneilqtlldlffpgyskgr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z6uB (B:)
    mgsshhhhhhssglvprgspsaskvykasdsaeaieafqltpqqqhliredcqnqklwde
    vlshlvegpnflkkleqsfmcvccqelvyqpvttecfhnvckdclqrsfkaqvfscpacr
    hdlgqnyimipneilqtlldlffpgyskgr
    

    Sequence, based on observed residues (ATOM records):
    >1z6uB (B:)
    eafqltpqqqhliredcqnqklwdevlshlvegpnflkkleqsfmcvccqelvyqpvtte
    cfhnvckdclqrsfkaqvfscpacrhdlgqnyimipneilqtlldlffpgyskgr