PDB entry 1z6t

View 1z6t on RCSB PDB site
Description: Structure of the apoptotic protease-activating factor 1 bound to ADP
Deposited on 2005-03-23, released 2005-04-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptotic protease activating factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: apoptotic protease activating factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: apoptotic protease activating factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: apoptotic protease activating factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z6tA (A:)
    mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
    lkkdndsyvsfynallhegykdlaallhdgipvvssssgkdsvsgitsyvrtvlceggvp
    qrpvvfvtrkklvnaiqqklsklkgepgwvtihgmagcgksvlaaeavrdhsllegcfpg
    gvhwvsvgkqdksgllmklqnlctrldqdesfsqrlplnieeakdrlrilmlrkhprsll
    ilddvwdswvlkafdsqcqillttrdksvtdsvmgpkyvvpvesslgkekgleilslfvn
    mkkadlpeqahsiikeckgsplvvsligallrdfpnrweyylkqlqnkqfkrirksssyd
    yealdeamsisvemlredikdyytdlsilqkdvkvptkvlcilwdmeteevedilqefvn
    ksllfcdrngksfryylhdlqvdfltekncsqlqdlhkkiitqfqryhqphtlspdqedc
    mywynflayhmasakmhkelcalmfsldwikaktelvgpahlihefveyrhildekdcav
    senfqeflslnghllgrqpfpnivqlglcepetsevyqqaklqakqevdng
    

    Sequence, based on observed residues (ATOM records):
    >1z6tA (A:)
    mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
    lkkdndsyvsfynallhegykdlaallhdgipvvgitsyvrtvlceggvpqrpvvfvtrk
    klvnaiqqklsklkgepgwvtihgmagcgksvlaaeavrdhsllegcfpggvhwvsvgkq
    dksgllmklqnlctrldqdesfsqrlplnieeakdrlrilmlrkhprsllilddvwdswv
    lkafdsqcqillttrdksvtdsvmgpkyvvpvesslgkekgleilslfvnmkkadlpeqa
    hsiikeckgsplvvsligallrdfpnrweyylkqlqnkqfkrirksssydyealdeamsi
    svemlredikdyytdlsilqkdvkvptkvlcilwdmeteevedilqefvnksllfcdrng
    ksfryylhdlqvdfltekncsqlqdlhkkiitqfqryhqphtlspdqedcmywynflayh
    masakmhkelcalmfsldwikaktelvgpahlihefveyrhildekdcavsenfqeflsl
    nghllgrqpfpnivqlglcepetsevyqqaklqakq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z6tB (B:)
    mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
    lkkdndsyvsfynallhegykdlaallhdgipvvssssgkdsvsgitsyvrtvlceggvp
    qrpvvfvtrkklvnaiqqklsklkgepgwvtihgmagcgksvlaaeavrdhsllegcfpg
    gvhwvsvgkqdksgllmklqnlctrldqdesfsqrlplnieeakdrlrilmlrkhprsll
    ilddvwdswvlkafdsqcqillttrdksvtdsvmgpkyvvpvesslgkekgleilslfvn
    mkkadlpeqahsiikeckgsplvvsligallrdfpnrweyylkqlqnkqfkrirksssyd
    yealdeamsisvemlredikdyytdlsilqkdvkvptkvlcilwdmeteevedilqefvn
    ksllfcdrngksfryylhdlqvdfltekncsqlqdlhkkiitqfqryhqphtlspdqedc
    mywynflayhmasakmhkelcalmfsldwikaktelvgpahlihefveyrhildekdcav
    senfqeflslnghllgrqpfpnivqlglcepetsevyqqaklqakqevdng
    

    Sequence, based on observed residues (ATOM records):
    >1z6tB (B:)
    mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
    lkkdndsyvsfynallhegykdlaallhdgipvvssssgkdsvsgitsyvrtvlceggvp
    qrpvvfvtrkklvnaiqqklsklkgepgwvtihgmagcgksvlaaeavrdhsllegcfpg
    gvhwvsvgkqdksgllmklqnlctrldqdesfsqrlplnieeakdrlrilmlrkhprsll
    ilddvwdswvlkafdsqcqillttrdksvtdsvmgpkyvvpvesslgkekgleilslfvn
    mkkadlpeqahsiikeckgsplvvsligallrdfpnrweyylkqlqnkqfkrirksssyd
    yealdeamsisvemlredikdyytdlsilqkdvkvptkvlcilwdmeteevedilqefvn
    ksllfcdrngksfryylhdlqvdfltekncsqlqdlhkkiitqfqryhqphtlspdqedc
    mywynflayhmasakmhkelcalmfsldwikaktelvgpahlihefveyrhildekdcav
    senfqeflslnghllgrqpfpnivqlglcepetsevyqqaklqakq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1z6tC (C:)
    mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
    lkkdndsyvsfynallhegykdlaallhdgipvvssssgkdsvsgitsyvrtvlceggvp
    qrpvvfvtrkklvnaiqqklsklkgepgwvtihgmagcgksvlaaeavrdhsllegcfpg
    gvhwvsvgkqdksgllmklqnlctrldqdesfsqrlplnieeakdrlrilmlrkhprsll
    ilddvwdswvlkafdsqcqillttrdksvtdsvmgpkyvvpvesslgkekgleilslfvn
    mkkadlpeqahsiikeckgsplvvsligallrdfpnrweyylkqlqnkqfkrirksssyd
    yealdeamsisvemlredikdyytdlsilqkdvkvptkvlcilwdmeteevedilqefvn
    ksllfcdrngksfryylhdlqvdfltekncsqlqdlhkkiitqfqryhqphtlspdqedc
    mywynflayhmasakmhkelcalmfsldwikaktelvgpahlihefveyrhildekdcav
    senfqeflslnghllgrqpfpnivqlglcepetsevyqqaklqakqevdng
    

    Sequence, based on observed residues (ATOM records):
    >1z6tC (C:)
    mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
    lkkdndsyvsfynallhegykdlaallhdgipvvssssgkdsvsgitsyvrtvlceggvp
    qrpvvfvtrkklvnaiqqklsklkgepgwvtihgmagcgksvlaaeavrdhsllegcfpg
    gvhwvsvgkqdksgllmklqnlctrldqdesfsqrlplnieeakdrlrilmlrkhprsll
    ilddvwdswvlkafdsqcqillttrdksvtdsvmgpkyvvpvesslgkekgleilslfvn
    mkkadlpeqahsiikeckgsplvvsligallrdfpnrweyylkqlqnkqfkrirksssyd
    yealdeamsisvemlredikdyytdlsilqkdvkvptkvlcilwdmeteevedilqefvn
    ksllfcdrngksfryylhdlqvdfltekncsqlqdlhkkiitqfqryhqphtlspdqedc
    mywynflayhmasakmhkelcalmfsldwikaktelvgpahlihefveyrhildekdcav
    senfqeflslnghllgrqpfpnivqlglcepetsevyqqaklqakq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1z6tD (D:)
    mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
    lkkdndsyvsfynallhegykdlaallhdgipvvssssgkdsvsgitsyvrtvlceggvp
    qrpvvfvtrkklvnaiqqklsklkgepgwvtihgmagcgksvlaaeavrdhsllegcfpg
    gvhwvsvgkqdksgllmklqnlctrldqdesfsqrlplnieeakdrlrilmlrkhprsll
    ilddvwdswvlkafdsqcqillttrdksvtdsvmgpkyvvpvesslgkekgleilslfvn
    mkkadlpeqahsiikeckgsplvvsligallrdfpnrweyylkqlqnkqfkrirksssyd
    yealdeamsisvemlredikdyytdlsilqkdvkvptkvlcilwdmeteevedilqefvn
    ksllfcdrngksfryylhdlqvdfltekncsqlqdlhkkiitqfqryhqphtlspdqedc
    mywynflayhmasakmhkelcalmfsldwikaktelvgpahlihefveyrhildekdcav
    senfqeflslnghllgrqpfpnivqlglcepetsevyqqaklqakqevdng
    

    Sequence, based on observed residues (ATOM records):
    >1z6tD (D:)
    mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
    lkkdndsyvsfynallhegykdlaallhdgipvvgitsyvrtvlceggvpqrpvvfvtrk
    klvnaiqqklsklkgepgwvtihgmagcgksvlaaeavrdhsllegcfpggvhwvsvgkq
    dksgllmklqnlctrldqdesfsqrlplnieeakdrlrilmlrkhprsllilddvwdswv
    lkafdsqcqillttrdksvtdsvmgpkyvvpvesslgkekgleilslfvnmkkadlpeqa
    hsiikeckgsplvvsligallrdfpnrweyylkqlqnkqfkrirksssydyealdeamsi
    svemlredikdyytdlsilqkdvkvptkvlcilwdmeteevedilqefvnksllfcdrng
    ksfryylhdlqvdfltekncsqlqdlhkkiitqfqryhqphtlspdqedcmywynflayh
    masakmhkelcalmfsldwikaktelvgpahlihefveyrhildekdcavsenfqeflsl
    nghllgrqpfpnivqlglcepetsevyqqaklqakq