PDB entry 1z6r

View 1z6r on RCSB PDB site
Description: Crystal structure of Mlc from Escherichia coli
Class: transcription
Keywords: transcriptional repressor, ROK family protein, DNA binding protein, helix-turn-helix, phosphotransferase system, metalloprotein, TRANSCRIPTION
Deposited on 2005-03-23, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mlc protein
    Species: Escherichia coli [TaxId:562]
    Gene: mlc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50456 (Start-405)
      • engineered (51)
      • modified residue (53)
      • modified residue (166)
      • modified residue (175)
      • modified residue (200)
      • modified residue (285)
      • modified residue (288)
      • modified residue (328)
      • modified residue (383)
      • modified residue (393)
    Domains in SCOPe 2.08: d1z6ra1, d1z6ra2, d1z6ra3
  • Chain 'B':
    Compound: Mlc protein
    Species: Escherichia coli [TaxId:562]
    Gene: mlc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50456 (Start-405)
      • engineered (51)
      • modified residue (53)
      • modified residue (166)
      • modified residue (175)
      • modified residue (200)
      • modified residue (285)
      • modified residue (288)
      • modified residue (328)
      • modified residue (383)
      • modified residue (393)
    Domains in SCOPe 2.08: d1z6rb1, d1z6rb2, d1z6rb3
  • Chain 'C':
    Compound: Mlc protein
    Species: Escherichia coli [TaxId:562]
    Gene: mlc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50456 (Start-405)
      • engineered (51)
      • modified residue (53)
      • modified residue (166)
      • modified residue (175)
      • modified residue (200)
      • modified residue (285)
      • modified residue (288)
      • modified residue (328)
      • modified residue (383)
      • modified residue (393)
    Domains in SCOPe 2.08: d1z6rc1, d1z6rc2, d1z6rc3
  • Chain 'D':
    Compound: Mlc protein
    Species: Escherichia coli [TaxId:562]
    Gene: mlc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50456 (Start-405)
      • engineered (51)
      • modified residue (53)
      • modified residue (166)
      • modified residue (175)
      • modified residue (200)
      • modified residue (285)
      • modified residue (288)
      • modified residue (328)
      • modified residue (383)
      • modified residue (393)
    Domains in SCOPe 2.08: d1z6rd1, d1z6rd2, d1z6rd3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6rA (A:)
    mvaenqpghidqikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlv
    qeleikeagnrgrpavglvveteawhylslrisrgeiflalrdlssklvveesqelalkd
    dlplldriishidqffirhqkklerltsiaitlpgiidtengivhrmpfyedvkemplge
    aleqhtgvpvyiqhdisawtmaealfgasrgardviqvvidhnvgagvitdghllhagss
    slveightqvdpygkrcycgnhgcletiasvdsilelaqlrlnqsmssmlhgqpltvdsl
    cqaalrgdllakdiitgvgahvgrilaimvnlfnpqkiligsplskaadilfpvisdsir
    qqalpaysqhisvestqfsnqgtmagaalvkdamyngsllirllqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6rA (A:)
    qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlvqelglvvetea
    whylslrisrgeiflalrdlssklvveesqelalkddlplldriishidqffirhqkkle
    rltsiaitlpgiidtengivhrmpfyedvkemplgealeqhtgvpvyiqhdisawtmaea
    lfgasrgardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgnhgc
    letiasvdsilelaqlrlnqsmssmlhgqpltvdslcqaalrgdllakdiitgvgahvgr
    ilaimvnlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnqgtm
    agaalvkdamyngsllirllqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z6rB (B:)
    mvaenqpghidqikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlv
    qeleikeagnrgrpavglvveteawhylslrisrgeiflalrdlssklvveesqelalkd
    dlplldriishidqffirhqkklerltsiaitlpgiidtengivhrmpfyedvkemplge
    aleqhtgvpvyiqhdisawtmaealfgasrgardviqvvidhnvgagvitdghllhagss
    slveightqvdpygkrcycgnhgcletiasvdsilelaqlrlnqsmssmlhgqpltvdsl
    cqaalrgdllakdiitgvgahvgrilaimvnlfnpqkiligsplskaadilfpvisdsir
    qqalpaysqhisvestqfsnqgtmagaalvkdamyngsllirllqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6rB (B:)
    qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlvqelglvvetea
    whylslrisrgeiflalrdlssklvveesqelalkddlplldriishidqffirhqkkle
    rltsiaitlpgiidtengivhrmpfyedvkemplgealeqhtgvpvyiqhdisawtmaea
    lfgasrgardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgnhgc
    letiasvdsilelaqlrlnqsmssmlhgqpltvdslcqaalrgdllakdiitgvgahvgr
    ilaimvnlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnqgtm
    agaalvkdamyngsllirllqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z6rC (C:)
    mvaenqpghidqikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlv
    qeleikeagnrgrpavglvveteawhylslrisrgeiflalrdlssklvveesqelalkd
    dlplldriishidqffirhqkklerltsiaitlpgiidtengivhrmpfyedvkemplge
    aleqhtgvpvyiqhdisawtmaealfgasrgardviqvvidhnvgagvitdghllhagss
    slveightqvdpygkrcycgnhgcletiasvdsilelaqlrlnqsmssmlhgqpltvdsl
    cqaalrgdllakdiitgvgahvgrilaimvnlfnpqkiligsplskaadilfpvisdsir
    qqalpaysqhisvestqfsnqgtmagaalvkdamyngsllirllqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6rC (C:)
    qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlvqelglvvetea
    whylslrisrgeiflalrdlssklvveesqelalkddlplldriishidqffirhqkkle
    rltsiaitlpgiidtengivhrmpfyedvkemplgealeqhtgvpvyiqhdisawtmaea
    lfgasrgardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgnhgc
    letiasvdsilelaqlrlnqsmssmlhgqpltvdslcqaalrgdllakdiitgvgahvgr
    ilaimvnlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnqgtm
    agaalvkdamyngsllirllqg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z6rD (D:)
    mvaenqpghidqikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlv
    qeleikeagnrgrpavglvveteawhylslrisrgeiflalrdlssklvveesqelalkd
    dlplldriishidqffirhqkklerltsiaitlpgiidtengivhrmpfyedvkemplge
    aleqhtgvpvyiqhdisawtmaealfgasrgardviqvvidhnvgagvitdghllhagss
    slveightqvdpygkrcycgnhgcletiasvdsilelaqlrlnqsmssmlhgqpltvdsl
    cqaalrgdllakdiitgvgahvgrilaimvnlfnpqkiligsplskaadilfpvisdsir
    qqalpaysqhisvestqfsnqgtmagaalvkdamyngsllirllqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6rD (D:)
    qikqtnagavyrlidqlgpvsridlsrlaqlapasitkivhemleahlvqelglvvetea
    whylslrisrgeiflalrdlssklvveesqelalkddlplldriishidqffirhqkkle
    rltsiaitlpgiidtengivhrmpfyedvkemplgealeqhtgvpvyiqhdisawtmaea
    lfgasrgardviqvvidhnvgagvitdghllhagssslveightqvdpygkrcycgnhgc
    letiasvdsilelaqlrlnqsmssmlhgqpltvdslcqaalrgdllakdiitgvgahvgr
    ilaimvnlfnpqkiligsplskaadilfpvisdsirqqalpaysqhisvestqfsnqgtm
    agaalvkdamyngsllirllqg