PDB entry 1z6p

View 1z6p on RCSB PDB site
Description: Glycogen phosphorylase AMP site inhibitor complex
Class: transferase
Keywords: GLYCOGEN METABOLISM; GLYCOGEN PHOSPHORYLASE B; INHIBITION; allosteric, TRANSFERASE
Deposited on 2005-03-23, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • conflict (379)
      • modified residue (679)
    Domains in SCOPe 2.07: d1z6pa_
  • Heterogens: 194, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6pA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6pA (A:)
    qekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgr
    wirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeie
    edaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlryg
    npwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsa
    kapngyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksskf
    rtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipe
    alerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinma
    hlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaei
    iaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnsl
    fdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiikl
    itaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfm
    lngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqii
    eqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvi
    rniatsgkfssdrtiaqyareiwgvepsrqrlp