PDB entry 1z6n

View 1z6n on RCSB PDB site
Description: 1.5 A Crystal Structure of a Protein of Unknown Function PA1234 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: Pseudomonas aeruginosa, alpha-beta-alpha sandwich, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-03-22, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA1234
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: gi:15596431
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z6na1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6nA (A:)
    masyaelfdigedfaafvghglateqgavarfrqklesnglpsalterlqrierryrllv
    agemwcpdcqinlaaldfaqrlqpnielaiiskgraeddlrqrlaleriaiplvlvldee
    fnllgrfverpqavldggpqalaaykagdylehaigdvlaiiegaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6nA (A:)
    masyaelfdigedfaafvghglateqgavarfrqklesnglpsalterlqrierryrllv
    agemwcpdcqinlaaldfaqrlqpnielaiiskgraeddlrqrlaleriaiplvlvldee
    fnllgrfverpqavldggpqalaaykagdylehaigdvlaiiegaa