PDB entry 1z6l

View 1z6l on RCSB PDB site
Description: crystal structure of Fms1 in complex with its substrate
Deposited on 2005-03-22, released 2005-09-27
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.237
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyamine oxidase FMS1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50264 (Start-507)
      • cloning artifact (508)
  • Chain 'B':
    Compound: Polyamine oxidase FMS1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50264 (Start-507)
      • cloning artifact (508)
  • Heterogens: FAD, DRE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z6lA (A:)
    mntvspakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkyd
    igaswhhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdn
    emskfaelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwk
    llsakdtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvnced
    gtvynadyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvife
    feeccwsnesskivtlanstnefveivrnaenldeldsmleredsqkhtsvtcwsqplff
    vnlskstgvasfmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrp
    ienianankpvlrniivsnwtrdpysrgaysacfpgddpvdmvvamsngqdsrirfageh
    timdgagcaygawesgrreatrisdllklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1z6lA (A:)
    pakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkydigasw
    hhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdnemskf
    aelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwkllsak
    dtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvncedgtvyn
    adyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvifefeecc
    wsnesskivtlanstnefveivrnaenldeldsmlertsvtcwsqplffvnlskstgvas
    fmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrpankpvlrniiv
    snwtrdpysrgaysacfpvdmvvamsngqdsrirfagehtimdgagcaygawesgrreat
    risdllkl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z6lB (B:)
    mntvspakkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkyd
    igaswhhdtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdn
    emskfaelefhqhlgvsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwk
    llsakdtyfghqgrnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvnced
    gtvynadyviitvpqsvlnlsvqpeknlrgriefqpplkpviqdafdkihfgalgkvife
    feeccwsnesskivtlanstnefveivrnaenldeldsmleredsqkhtsvtcwsqplff
    vnlskstgvasfmmlmqapltnhiesiredkerlfsffqpvlnkimkcldsedvidgmrp
    ienianankpvlrniivsnwtrdpysrgaysacfpgddpvdmvvamsngqdsrirfageh
    timdgagcaygawesgrreatrisdllklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1z6lB (B:)
    kkkviiigagiaglkaastlhqngiqdclvleardrvggrlqtvtgyqgrkydigaswhh
    dtltnplfleeaqlslndgrtrfvfdddnfiyideergrvdhdkellleivdnemskfae
    lefhsdcsffqlvmkyllqrrqfltndqirylpqlcrylelwhgldwkllsakdtyfghq
    grnafalnydsvvqriaqsfpqnwlklscevksitrepsknvtvncedgtvynadyviit
    vpqsvlnlsvqpnlrgriefqpplkpviqdafdkihfgalgkvifefeeccwsnesskiv
    tlanstnefveivrnaenldeldsmlertsvtcwsqplffvnlskstgvasfmmlmqapl
    tnhiesiredkerlfsffqpvlnkimkcldsedvidgmrpenianankpvlrniivsnwt
    rdpysrgaysacfpvdmvvamsngqdsrirfagehtimdgagcaygawesgrreatrisd
    llkl