PDB entry 1z6i

View 1z6i on RCSB PDB site
Description: Crystal structure of the ectodomain of Drosophila transmembrane receptor PGRP-LCa
Class: membrane protein,immune system
Keywords: MIXED BETA-SHEET, 3/10 helix, MEMBRANE PROTEIN,IMMUNE SYSTEM
Deposited on 2005-03-22, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan-recognition protein-LC
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: PGRP-LC, ird7, PGRPLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GNK5 (0-166)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1z6ia1, d1z6ia2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6iA (A:)
    dfverqqwlaqppqkeipdlelpvglvialptnsencstqaicvlrvrllqtydiessqk
    cdiaynfliggdgnvyvgrgwnkmgahmnninydsqslsfayigsfktiqpsakqlsvtr
    lllergvklgkiapsyrftassklmpsvtdfkadalyasfanwthws