PDB entry 1z6h

View 1z6h on RCSB PDB site
Description: Solution Structure of Bacillus subtilis BLAP biotinylated-form
Deposited on 2005-03-22, released 2006-03-22
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biotin/Lipoyl Attachment Protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BTI

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z6hA (A:)
    tvsiqmagnlwkvhvkagdqiekgqevailesmkmeipivadrsgivkevkkkegdfvne
    gdvllelsnstq