PDB entry 1z6g

View 1z6g on RCSB PDB site
Description: Crystal structure of guanylate kinase from Plasmodium falciparum
Class: transferase
Keywords: guanylate kinase, Structural Genomics, SGC, Structural Genomics Consortium, TRANSFERASE
Deposited on 2005-03-22, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.219
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanylate kinase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z6ga_
  • Heterogens: SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6gA (A:)
    mgsshhhhhhssglvprgsmnniyplvicgpsgvgkgtlikkllnefpnyfyfsvscttr
    kkrekekegvdyyfidktifedklknedfleydnyannfygtlkseydkakeqnkiclfe
    mningvkqlkksthiknalyifikppstdvllsrlltrntenqeqiqkrmeqlnielhea
    nllnfnlsiinddltltyqqlknyllnsyihlnnhtrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6gA (A:)
    niyplvicgpsgvgkgtlikkllnefpnyfyfsvscttrkkrekekegvdyyfidktife
    dklknedfleydnyannfygtlkseydkakeqnkiclfemningvkqlkksthiknalyi
    fikppstdvllsrlltrntenqeqiqkrmeqlnielheanllnfnlsiinddltltyqql
    knyllnsyihl