PDB entry 1z6f

View 1z6f on RCSB PDB site
Description: Crystal structure of penicillin-binding protein 5 from E. coli in complex with a boronic acid inhibitor
Class: hydrolase
Keywords: peptidoglycan synthesis, penicillin-binding protein, dd-carboxypeptidase, hydrolase, boronic acid
Deposited on 2005-03-22, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 5
    Species: Escherichia coli [TaxId:562]
    Gene: dacA, pfv
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z6fa1, d1z6fa2
  • Heterogens: BO9, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6fA (A:)
    ddlniktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamka
    gkfketdlvtigndawatgnpvfkgsslmflkpgmqvpvsqlirginlqsgndacvamad
    faagsqdafvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpney
    siykekeftfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavm
    ggrtfkgreaeskklltwgfrffetvnplkvgkefasepvwfgdsdraslgvdkdvylti
    prgrmkdlkasyvlnsselhaplqknqvvgtinfqldgktieqrplvvlqeipegnfgdp
    vid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6fA (A:)
    niktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamkagkf
    ketdlvtigndawatgnpvfkgsslmflkpgmqvpvsqlirginlqsgndacvamadfaa
    gsqdafvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpneysiy
    kekeftfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavmggr
    tfkgreaeskklltwgfrffetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprg
    rmkdlkasyvlnsselhaplqknqvvgtinfqldgktieqrplvvlqeipegnf