PDB entry 1z6c

View 1z6c on RCSB PDB site
Description: Solution structure of an EGF pair (EGF34) from vitamin K-dependent protein S
Deposited on 2005-03-22, released 2005-06-21
The last revision was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin K-dependent protein S
    Species: Homo sapiens [TaxId:9606]
    Gene: PROS1, PROS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z6cA (A:)
    kdvdecslkpsicgtavcknipgdfececpegyrynlkskscedidecsenmcaqlcvny
    pggytcycdgkkgfklaqdqkscevvs