PDB entry 1z6b

View 1z6b on RCSB PDB site
Description: Crystal structure of Plasmodium falciparum FabZ at 2.1 A
Class: lyase
Keywords: Plasmodium falciparum, malaria, beta-hydroxyacyl-ACP dehydratase, fatty acid biosynthesis, SAD phasing, LYASE
Deposited on 2005-03-22, released 2005-06-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.177
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid synthesis protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: pffabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1z6ba1
  • Chain 'B':
    Compound: fatty acid synthesis protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: pffabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1z6bb_
  • Chain 'C':
    Compound: fatty acid synthesis protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: pffabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1z6bc_
  • Chain 'D':
    Compound: fatty acid synthesis protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: pffabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1z6bd_
  • Chain 'E':
    Compound: fatty acid synthesis protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: pffabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1z6be_
  • Chain 'F':
    Compound: fatty acid synthesis protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: pffabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1z6bf_
  • Heterogens: CL, CAC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6bA (A:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6bA (A:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksdnnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiakl
    sgvgyvngkvvinisemtfals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z6bB (B:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6bB (B:)
    tsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvl
    qiealaqlagilclksdlfagvdgvrwkkpvlpgdtltmqanlisfkgiaklsgvgyvng
    kvvinisemtfa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z6bC (C:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6bC (C:)
    sidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgvlq
    iealaqlagilclksdnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiaklsgv
    gyvngkvvinisemtfal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z6bD (D:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6bD (D:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksnlflfagvdgvrwkkpvlpgdtltmqanlisfaklsgvgyvng
    kvvinisemtfa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z6bE (E:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6bE (E:)
    dtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpgv
    lqiealaqlagilclksnnlflfagvdgvrwkkpvlpgdtltmqanlisfkgiaklsgvg
    yvngkvvinisemtfal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1z6bF (F:)
    gshmpnydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpq
    kqimpgvlqiealaqlagilclksddsqknnlflfagvdgvrwkkpvlpgdtltmqanli
    sfksslgiaklsgvgyvngkvvinisemtfalsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6bF (F:)
    ydtsidiedikkilphrypfllvdkviymqpnktiiglkqvstnepffnghfpqkqimpg
    vlqiealaqlagilclksdnnlflfagvdgvrwkkpvlpgdtltmqanlisfksslgiak
    lsgvgyvngkvvinisemtfal