PDB entry 1z6a

View 1z6a on RCSB PDB site
Description: Sulfolobus solfataricus SWI2/SNF2 ATPase core domain
Class: hydrolase/recombination
Keywords: hydrolase, recombination, hydrolase-recombination complex
Deposited on 2005-03-22, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Helicase of the snf2/rad54 family
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97XQ5 (24-382)
      • expression tag (13-23)
    • GB NP_343078 (383-End)
    Domains in SCOPe 2.07: d1z6aa2, d1z6aa3, d1z6aa4
  • Heterogens: HG, PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z6aA (A:)
    mgsshhhhhhssglvprgshmasksfqllepynikanlrpyqikgfswmrfmnklgfgic
    laddmglgktlqtiavfsdakkeneltpslvicplsvlknweeelskfaphlrfavfhed
    rskikledydiilttyavllrdtrlkevewkyivideaqniknpqtkifkavkelkskyr
    ialtgtpienkvddlwsimtflnpgllgsysefkskfatpikkgdnmakeelkaiispfi
    lrrtkydkaiindlpdkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilst
    llklkqivdhpallkggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirni
    iekelntevpflygelskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfd
    rwwnpavedqatdrvyrigqtrnvivhklisvgtleekidqllafkrslfkdiissgdsw
    itelsteelrkvielsvggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z6aA (A:)
    lvprgshmasksfqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqt
    iavfsdakkeneltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiil
    ttyavllrdtrlkevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvd
    dlwsimtflnpgllgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiind
    lpdkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpal
    lkggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpfly
    gelskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfdrwwdqatdrvyri
    gqtrnvivhklisvgtleekidqllafkrslfkdiissgdswitelsteelrkvielsvg