PDB entry 1z69

View 1z69 on RCSB PDB site
Description: Crystal structure of methylenetetrahydromethanopterin reductase (Mer) in complex with coenzyme F420
Class: oxidoreductase
Keywords: (alpha, beta)8 barrel, OXIDOREDUCTASE
Deposited on 2005-03-22, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.185
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coenzyme F420-dependent N(5),N(10)-methylenetetrahydromethanopterin reductase
    Species: Methanosarcina barkeri [TaxId:2208]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00297132 (0-326)
    Domains in SCOPe 2.07: d1z69a_
  • Chain 'B':
    Compound: Coenzyme F420-dependent N(5),N(10)-methylenetetrahydromethanopterin reductase
    Species: Methanosarcina barkeri [TaxId:2208]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00297132 (0-326)
    Domains in SCOPe 2.07: d1z69b_
  • Chain 'C':
    Compound: Coenzyme F420-dependent N(5),N(10)-methylenetetrahydromethanopterin reductase
    Species: Methanosarcina barkeri [TaxId:2208]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00297132 (0-326)
    Domains in SCOPe 2.07: d1z69c_
  • Chain 'D':
    Compound: Coenzyme F420-dependent N(5),N(10)-methylenetetrahydromethanopterin reductase
    Species: Methanosarcina barkeri [TaxId:2208]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00297132 (0-326)
    Domains in SCOPe 2.07: d1z69d_
  • Heterogens: CL, F42, 1PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z69A (A:)
    mkfgiefvpsdpalkiayyaklseqqgfdhvwitdhynnrdvystltvlalntnsikigp
    gvtnsytrnpaitassiasiaeisggravlglgpgdkatfdamgiawkkplattkeaiqa
    irdfisgkkvsmdgemikfagaklafkagnipiymgaqgpkmlelageiadgvlinashp
    kdfevaveqikkgaekagrdpsevdvtayacfsidkdpvkavnaakvvvafivagspdlv
    lerhgipveaksqigaaiakgdfgalmgglvtpqmieafsicgtpddcmkrikdleaigv
    tqivagspigpakekaikligkeiiak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z69B (B:)
    mkfgiefvpsdpalkiayyaklseqqgfdhvwitdhynnrdvystltvlalntnsikigp
    gvtnsytrnpaitassiasiaeisggravlglgpgdkatfdamgiawkkplattkeaiqa
    irdfisgkkvsmdgemikfagaklafkagnipiymgaqgpkmlelageiadgvlinashp
    kdfevaveqikkgaekagrdpsevdvtayacfsidkdpvkavnaakvvvafivagspdlv
    lerhgipveaksqigaaiakgdfgalmgglvtpqmieafsicgtpddcmkrikdleaigv
    tqivagspigpakekaikligkeiiak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z69C (C:)
    mkfgiefvpsdpalkiayyaklseqqgfdhvwitdhynnrdvystltvlalntnsikigp
    gvtnsytrnpaitassiasiaeisggravlglgpgdkatfdamgiawkkplattkeaiqa
    irdfisgkkvsmdgemikfagaklafkagnipiymgaqgpkmlelageiadgvlinashp
    kdfevaveqikkgaekagrdpsevdvtayacfsidkdpvkavnaakvvvafivagspdlv
    lerhgipveaksqigaaiakgdfgalmgglvtpqmieafsicgtpddcmkrikdleaigv
    tqivagspigpakekaikligkeiiak
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z69D (D:)
    mkfgiefvpsdpalkiayyaklseqqgfdhvwitdhynnrdvystltvlalntnsikigp
    gvtnsytrnpaitassiasiaeisggravlglgpgdkatfdamgiawkkplattkeaiqa
    irdfisgkkvsmdgemikfagaklafkagnipiymgaqgpkmlelageiadgvlinashp
    kdfevaveqikkgaekagrdpsevdvtayacfsidkdpvkavnaakvvvafivagspdlv
    lerhgipveaksqigaaiakgdfgalmgglvtpqmieafsicgtpddcmkrikdleaigv
    tqivagspigpakekaikligkeiiak