PDB entry 1z68

View 1z68 on RCSB PDB site
Description: crystal structure of human fibroblast activation protein alpha
Deposited on 2005-03-21, released 2005-04-12
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast activation protein, alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: fibroblast activation protein, alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1z68A (A:)
    mraltlkdilngtfsyktffpnwisgqeylhqsadnnivlynietgqsytilsnrtmksv
    nasnyglspdrqfvylesdysklwrysytatyyiydlsngefvrgnelprpiqylcwspv
    gsklayvyqnniylkqrpgdppfqitfngrenkifngipdwvyeeemlatkyalwwspng
    kflayaefndtdipviaysyygdeqyprtinipypkagaknpvvrifiidttypayvgpq
    evpvpamiassdyyfswltwvtdervclqwlkrvqnvsvlsicdfredwqtwdcpktqeh
    ieesrtgwaggffvstpvfsydaisyykifsdkdgykhihyikdtvenaiqitsgkweai
    nifrvtqdslfyssnefeeypgrrniyrisigsyppskkcvtchlrkercqyytasfsdy
    akyyalvcygpgipistlhdgrtdqeikileenkelenalkniqlpkeeikklevdeitl
    wykmilppqfdrskkyplliqvyggpcsqsvrsvfavnwisylaskegmvialvdgrgta
    fqgdkllyavyrklgvyevedqitavrkfiemgfidekriaiwgwsyggyvsslalasgt
    glfkcgiavapvssweyyasvyterfmglptkddnlehyknstvmaraeyfrnvdyllih
    gtaddnvhfqnsaqiakalvnaqvdfqamwysdqnhglsglstnhlythmthflkqcfs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1z68B (B:)
    mraltlkdilngtfsyktffpnwisgqeylhqsadnnivlynietgqsytilsnrtmksv
    nasnyglspdrqfvylesdysklwrysytatyyiydlsngefvrgnelprpiqylcwspv
    gsklayvyqnniylkqrpgdppfqitfngrenkifngipdwvyeeemlatkyalwwspng
    kflayaefndtdipviaysyygdeqyprtinipypkagaknpvvrifiidttypayvgpq
    evpvpamiassdyyfswltwvtdervclqwlkrvqnvsvlsicdfredwqtwdcpktqeh
    ieesrtgwaggffvstpvfsydaisyykifsdkdgykhihyikdtvenaiqitsgkweai
    nifrvtqdslfyssnefeeypgrrniyrisigsyppskkcvtchlrkercqyytasfsdy
    akyyalvcygpgipistlhdgrtdqeikileenkelenalkniqlpkeeikklevdeitl
    wykmilppqfdrskkyplliqvyggpcsqsvrsvfavnwisylaskegmvialvdgrgta
    fqgdkllyavyrklgvyevedqitavrkfiemgfidekriaiwgwsyggyvsslalasgt
    glfkcgiavapvssweyyasvyterfmglptkddnlehyknstvmaraeyfrnvdyllih
    gtaddnvhfqnsaqiakalvnaqvdfqamwysdqnhglsglstnhlythmthflkqcfs