PDB entry 1z67

View 1z67 on RCSB PDB site
Description: Structure of Homeodomain-like Protein of Unknown Function S4005 from Shigella flexneri
Class: Structural Genomics, Unknown Function
Keywords: structural genomics, hypothetical protein, Shigella flexneri, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Unknown Function
Deposited on 2005-03-21, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.164
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein S4005
    Species: Shigella flexneri 2a [TaxId:198215]
    Gene: yidB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83IZ7
      • modified residue (125)
    Domains in SCOPe 2.07: d1z67a1
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z67A (A:)
    snamglfdevvgaflkgdagkyqailswveeqggiqvlleklqsgglgailstwlsnqqr
    nqsvsgeqlesalgtnavsdlgqklgvdtstassllaeqlpkiidalspqgevsaqannd
    llsagmellkgklfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z67A (A:)
    lfdevvgaflkgdagkyqailswveeqggiqvlleklqsgglgailstwlsnqqrnqsvs
    geqlesalgtnavsdlgqklgvdtstassllaeqlpkiidalspqgevqanndllsagme
    llkgklf