PDB entry 1z63

View 1z63 on RCSB PDB site
Description: Sulfolobus solfataricus SWI2/SNF2 ATPase core in complex with dsDNA
Class: HYDROLASE/DNA complex
Keywords: protein-DNA complex, HYDROLASE-DNA complex COMPLEX
Deposited on 2005-03-21, released 2005-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.233
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Helicase of the snf2/rad54 family
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97XQ5 (Start-382)
      • expression tag (90)
    • Uniprot Q97XQ5 (383-495)
    Domains in SCOPe 2.06: d1z63a1, d1z63a2
  • Chain 'B':
    Compound: Helicase of the snf2/rad54 family
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97XQ5 (Start-382)
      • expression tag (90)
    • Uniprot Q97XQ5 (383-495)
    Domains in SCOPe 2.06: d1z63b1, d1z63b2
  • Chain 'C':
    Compound: 5'-d(*ap*ap*ap*ap*ap*a*ap*tp*tp*gp*cp*cp*gp*ap*ap*gp*ap*cp*gp*ap*ap*ap*ap*ap*a)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*tp*tp*tp*tp*tp*tp*cp*gp*tp*cp*tp*tp*cp*gp*gp*cp*ap*ap*tp*tp*tp*tp*tp*t)-3'
  • Chain 'E':
    Compound: 5'-d(*ap*ap*ap*ap*ap*a*ap*tp*tp*gp*cp*cp*gp*ap*ap*gp*ap*cp*gp*ap*ap*ap*ap*ap*a)-3'
  • Chain 'F':
    Compound: 5'-d(*tp*tp*tp*tp*tp*tp*tp*cp*gp*tp*cp*tp*tp*cp*gp*gp*cp*ap*ap*tp*tp*tp*tp*tp*t)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z63A (A:)
    mgsshhhhhhssglvprgshmasksfqllepynikanlrpyqikgfswmrfmnklgfgic
    laddmglgktlqtiavfsdakkeneltpslvicplsvlknweeelskfaphlrfavfhed
    rskikledydiilttyavllrdtrlkevewkyivideaqniknpqtkifkavkelkskyr
    ialtgtpienkvddlwsimtflnpgllgsysefkskfatpikkgdnmakeelkaiispfi
    lrrtkydkaiindlpdkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilst
    llklkqivdhpallkggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirni
    iekelntevpflygelskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfd
    rwwnpavedqatdrvyrigqtrnvivhklisvgtleekidqllafkrslfkdiissgdsw
    itelsteelrkvielsvggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z63A (A:)
    fqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqtiavfsdakkene
    ltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiilttyavllrdtrl
    kevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvddlwsimtflnpg
    llgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiindlpdkietnvycn
    ltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpallkggeqsvrrsg
    kmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpflygelskkerddii
    skfqnnpsvkfivlsvkagfginltsanrvihfdrwwnpdqatdrvyrigqtrnvivhkl
    isvgtleekidqllafkrslfkdiissgdswitelsteelrkvielsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z63B (B:)
    mgsshhhhhhssglvprgshmasksfqllepynikanlrpyqikgfswmrfmnklgfgic
    laddmglgktlqtiavfsdakkeneltpslvicplsvlknweeelskfaphlrfavfhed
    rskikledydiilttyavllrdtrlkevewkyivideaqniknpqtkifkavkelkskyr
    ialtgtpienkvddlwsimtflnpgllgsysefkskfatpikkgdnmakeelkaiispfi
    lrrtkydkaiindlpdkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilst
    llklkqivdhpallkggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirni
    iekelntevpflygelskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfd
    rwwnpavedqatdrvyrigqtrnvivhklisvgtleekidqllafkrslfkdiissgdsw
    itelsteelrkvielsvggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z63B (B:)
    fqllepynikanlrpyqikgfswmrfmnklgfgicladdmglgktlqtiavfsdakkene
    ltpslvicplsvlknweeelskfaphlrfavfhedrskikledydiilttyavllrdtrl
    kevewkyivideaqniknpqtkifkavkelkskyrialtgtpienkvddlwsimtflnpg
    llgsysefkskfatpikkgdnmakeelkaiispfilrrtkydkaiindlpdkietnvycn
    ltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpallkggeqsvrrsg
    kmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpflygelskkerddii
    skfqnnpsvkfivlsvkagfginltsanrvihfdrwwnpdqatdrvyrigqtrnvivhkl
    isvgtleekidqllafkrslfkdiissgdswitelsteelrkvielsv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.