PDB entry 1z60

View 1z60 on RCSB PDB site
Description: Solution structure of the carboxy-terminal domain of human TFIIH P44 subunit
Class: transcription
Keywords: Basic transcription factor, zinc binding protein, ring finger
Deposited on 2005-03-21, released 2005-04-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: TFIIH basal transcription factor complex p44 subunit
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13888 (0-58)
    • engineered (53)
  Domains in SCOPe 2.02: d1z60a1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z60A (A:)
  ldafqeipleeyngerfcygcqgelkdqhvyvcavcqnvfcvdcdvfvhdslhscpgci