PDB entry 1z5z

View 1z5z on RCSB PDB site
Description: Sulfolobus solfataricus SWI2/SNF2 ATPase C-terminal domain
Class: hydrolase/recombination
Keywords: hydrolase, recombination, hydrolase-recombination complex
Deposited on 2005-03-21, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Helicase of the snf2/rad54 family
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97XQ5 (Start-153)
    • GB NP_343078 (154-270)
    Domains in SCOPe 2.07: d1z5za1
  • Chain 'B':
    Compound: Helicase of the snf2/rad54 family
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97XQ5 (Start-153)
    • GB NP_343078 (154-End)
    Domains in SCOPe 2.07: d1z5zb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z5zA (A:)
    mgsshhhhhhssglvprgshmasdlpdkietnvycnltpeqaamykaevenlfnnidsvt
    gikrkgmilstllklkqivdhpallkggeqsvrrsgkmirtmeiieealdegdkiaiftq
    fvdmgkiirniiekelntevpflygelskkerddiiskfqnnpsvkfivlsvkaggfgin
    ltsanrvihfdrwwnpavedqatdrvyrigqtrnvivhklisvgtleekidqllafkrsl
    fkdiissgdswitelsteelrkvielsvggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5zA (A:)
    kietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpallkg
    geqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpflygel
    skkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfdrwwnpavenvivhkli
    svgtleekidqllafkrslfkdiissgdswitelsteelrkvielsvggy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z5zB (B:)
    mgsshhhhhhssglvprgshmasdlpdkietnvycnltpeqaamykaevenlfnnidsvt
    gikrkgmilstllklkqivdhpallkggeqsvrrsgkmirtmeiieealdegdkiaiftq
    fvdmgkiirniiekelntevpflygelskkerddiiskfqnnpsvkfivlsvkaggfgin
    ltsanrvihfdrwwnpavedqatdrvyrigqtrnvivhklisvgtleekidqllafkrsl
    fkdiissgdswitelsteelrkvielsvggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5zB (B:)
    dkietnvycnltpeqaamykaevenlfnnidsvtgikrkgmilstllklkqivdhpallk
    ggeqsvrrsgkmirtmeiieealdegdkiaiftqfvdmgkiirniiekelntevpflyge
    lskkerddiiskfqnnpsvkfivlsvkaggfginltsanrvihfdrwwnpavenvivhkl
    isvgtleekidqllafkrslfkdiissgdswitelsteelrkvielsv