PDB entry 1z5y

View 1z5y on RCSB PDB site
Description: Crystal Structure Of The Disulfide-Linked Complex Between The N-Terminal Domain Of The Electron Transfer Catalyst DsbD and The Cytochrome c Biogenesis Protein CcmG
Class: oxidoreductase/biosynthetic protein
Keywords: dsbd, n-terminal domain, immunoglobulin-like, ccmg, thioredoxin-like, disulfide-linked, oxidoreductase/biosynthetic protein complex
Deposited on 2005-03-21, released 2005-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.235
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Thiol:disulfide interchange protein dsbD
    Species: Escherichia coli [TaxId:562]
    Gene: DSBD, DIPZ, CYCZ, CUTA2, B4136
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36655
      • engineered (102)
    Domains in SCOPe 2.08: d1z5yd_
  • Chain 'E':
    Compound: Thiol:disulfide interchange protein dsbE
    Species: Escherichia coli [TaxId:562]
    Gene: DSBE, CCMG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA86
      • engineered (40)
    Domains in SCOPe 2.08: d1z5ye1
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z5yD (D:)
    glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
    pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
    evvannaapqpvsvpqqeqptaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5yD (D:)
    rsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhe
    defygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplsevvan
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1z5yE (E:)
    kpvpkfrlesldnpgqfyqadvltqgkpvllnvwatwcptsraehqylnqlsaqgirvvg
    mnykddrqkaiswlkelgnpyalslfdgdgmlgldlgvygapetflidgngiiryrhagd
    lnprvweeeikplwekyskeaaqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5yE (E:)
    rlesldnpgqfyqadvltqgkpvllnvwatwcptsraehqylnqlsaqgirvvgmnykdd
    rqkaiswlkelgnpyalslfdgdgmlgldlgvygapetflidgngiiryrhagdlnprvw
    eeeikplwekyskeaa