PDB entry 1z5v

View 1z5v on RCSB PDB site
Description: Crystal structure of human gamma-tubulin bound to GTPgammaS
Class: structural protein
Keywords: structural protein
Deposited on 2005-03-20, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.237
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin gamma-1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: TUBG1, TUBG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z5va1, d1z5va2
  • Heterogens: MG, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z5vA (A:)
    mpreiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehy
    ipravlldleprvihsilnspyaklynpeniylsehgggagnnwasgfsqgekihedifd
    iidreadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsd
    vvvqpynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsast
    ttlrypgymnndligliasliptprlhflmtgytplttdqsvasvrkttvldvmrrllqp
    knvmvstgrdrqtnhcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqval
    srkspylpsahrvsglmmanhtsisslfertcrqydklrkreafleqfrkedmfkdnfde
    mdtsreivqqlideyhaatrpdyiswgtqvdvdggeqkliseedlllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5vA (A:)
    preiitlqlgqcgnqigfefwkqlcaehgispeaivtdrkdvffyqaddehyipravlld
    leprvihsilnspyaklynpeniylsgnnwasgfsqgekihedifdiidreadgsdsleg
    fvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqsdvvvqpynslltlkrltq
    nadclvvldntalnriatdrlhiqnpsfsqinqlvstimsastttlrypgymnndligli
    asliptprlhflmtgytplttdqsvrkttvldvmrrllqpknvmvstgtnhcyiailnii
    qgevdptqvhkslqrirerklanfipwgpasiqvalsrkspylrvsglmmanhtsisslf
    ertcrqydklrkreafleqfrkedmfkdnfdemdtsreivqqlideyhaatr