PDB entry 1z5u

View 1z5u on RCSB PDB site
Description: Crystal structure of S. typhimurium AphA complexed with cyclic-AMP
Class: hydrolase
Keywords: Class-B bacterial acid phosphatase, cyclic-AMP complex of AphA protein, metalloenzyme, HYDROLASE
Deposited on 2005-03-20, released 2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • GB AAW22868 (Start-213)
    Domains in SCOPe 2.08: d1z5ua_
  • Chain 'B':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • GB AAW22868 (Start-213)
    Domains in SCOPe 2.08: d1z5ub_
  • Chain 'C':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • GB AAW22868 (Start-213)
    Domains in SCOPe 2.08: d1z5uc_
  • Chain 'D':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed):
    • GB AAW22868 (Start-213)
    Domains in SCOPe 2.08: d1z5ud_
  • Heterogens: MG, CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z5uA (A:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5uA (A:)
    tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
    pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
    tladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirgir
    ilraanstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z5uB (B:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5uB (B:)
    pstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkt
    yspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetv
    sktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirg
    irilraanstykplpqagafgeevivnsey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z5uC (C:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5uC (C:)
    tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
    pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
    tladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirgir
    ilraanstykplpqagafgeevivnsey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z5uD (D:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5uD (D:)
    pstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkt
    yspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetv
    sktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirg
    irilraanstykplpqagafgeevivnsey