PDB entry 1z5r

View 1z5r on RCSB PDB site
Description: Crystal Structure of Activated Porcine Pancreatic Carboxypeptidase B
Class: hydrolase
Keywords: carboxypeptidase B, exopeptidase, Hydrolase
Deposited on 2005-03-18, released 2005-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Procarboxypeptidase B
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z5ra1
  • Chain 'B':
    Compound: Procarboxypeptidase B
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z5rb_
  • Chain 'C':
    Compound: Procarboxypeptidase B
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z5rc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z5rA (A:)
    ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
    mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
    rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
    rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
    gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
    yvlghl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5rA (A:)
    ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
    cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
    wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
    nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
    ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
    lghl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z5rB (B:)
    ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
    mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
    rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
    rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
    gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
    yvlghl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5rB (B:)
    ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
    cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
    wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
    nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
    ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
    lghl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z5rC (C:)
    ttghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaif
    mdcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtkn
    rmwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfi
    rnnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygp
    gattiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtn
    yvlghl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5rC (C:)
    ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
    cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
    wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
    nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
    ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
    lghl