PDB entry 1z5p

View 1z5p on RCSB PDB site
Description: Crystal structure of MTA/AdoHcy nucleosidase with a ligand-free purine binding site
Class: hydrolase
Keywords: mixed alpha/beta, HYDROLASE
Deposited on 2005-03-18, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MTA/SAH nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: mtnN, mtn, pfs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z5pa_
  • Heterogens: PE5, GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z5pA (A:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5pA (A:)
    mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
    lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
    addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
    vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg