PDB entry 1z5o

View 1z5o on RCSB PDB site
Description: Crystal structure of MTA/AdoHcy nucleosidase Asp197Asn mutant complexed with 5'-methylthioadenosine
Class: hydrolase
Keywords: mixed alpha/beta, HYDROLASE
Deposited on 2005-03-18, released 2005-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MTA/SAH nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: mtnN, mtn, pfs
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24247 (10-241)
      • cloning artifact (7-9)
      • engineered (206)
    Domains in SCOPe 2.08: d1z5oa1, d1z5oa2
  • Chain 'B':
    Compound: MTA/SAH nucleosidase
    Species: Escherichia coli [TaxId:562]
    Gene: mtnN, mtn, pfs
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24247 (10-241)
      • engineered (206)
    Domains in SCOPe 2.08: d1z5ob_
  • Heterogens: MTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z5oA (A:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisnvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5oA (A:)
    efsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaal
    gatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpa
    gfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeata
    iahvchnfnvpfvvvraisnvadqqshlsfdeflavaakqsslmveslvqklahg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z5oB (B:)
    fqgamdpefsmkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgi
    gkvaaalgatlllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeyg
    qlpgcpagfkaddkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaia
    vemeataiahvchnfnvpfvvvraisnvadqqshlsfdeflavaakqsslmveslvqkla
    hg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5oB (B:)
    mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
    lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
    addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
    vchnfnvpfvvvraisnvadqqshlsfdeflavaakqsslmveslvqklahg