PDB entry 1z5m

View 1z5m on RCSB PDB site
Description: Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl)amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2-dimethylpropanediamide Complexed with Human PDK1
Class: Transferase
Keywords: protein inhibitor complex, serine kinase
Deposited on 2005-03-18, released 2005-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.212
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide dependent protein kinase-1
    Species: HOMO SAPIENS
    Gene: PDPK1, PDK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15530 (0-285)
      • modified residue (167)
    Domains in SCOP 1.73: d1z5ma1
  • Heterogens: SO4, CL, LI8, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z5mA (A:)
    prkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdv
    msrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsal
    eylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspel
    lteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlv
    ekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5mA (A:)
    prkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdv
    msrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsal
    eylhgkgiihrdlkpenillnedmhiqitdfgtakvlsfvgtaqyvspellteksackss
    dlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldatk
    rlgceemegygplkahpffesvtwenlhqqtppklt