PDB entry 1z5h

View 1z5h on RCSB PDB site
Description: Crystal structures of the Tricorn interacting Factor F3 from Thermoplasma acidophilum
Class: hydrolase
Keywords: Zinc aminopeptidase, Gluzicins, Tricorn protease, Superhelix, HYDROLASE
Deposited on 2005-03-18, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tricorn protease interacting factor F3
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z5ha1, d1z5ha2, d1z5ha3, d1z5ha4
  • Chain 'B':
    Compound: Tricorn protease interacting factor F3
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z5hb1, d1z5hb2, d1z5hb3, d1z5hb4
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z5hA (A:)
    mevekydltldfdiqkrtfngtetitadagdivldavglqinwmkvngrdtaftydgqtv
    rapgdsqpqkieisfagkvsdslsgiyyagrengmitthfeatdarrmfpcvdhpaykav
    faitvvidkdydaisnmppkrievserkvvefqdtprmstyllyvgigkfryeyekyrdi
    dlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgagamenwgaitf
    reiymdiaensavtvkrnsanviaheiahqwfgdlvtmkwwndlwlnesfatfmsyktmd
    tlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeisygkgasilrm
    iedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeywiknpgypvik
    lkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadglikinads
    agfyrvlyddatfsdvmghyrdlspldriglvddlfafllsghidpetyrqrirnffdde
    dhnvitaivgqmeylrmlthafdddarafcrsrmqfltgkqdenlkialgrvsrlyvmvd
    esyaeemsklfkdfdsaepemrssiatayalvtgdlkgllekfrsvdrdedrvriisafg
    klksntdlstvygmvekteikkqdmisffssaletlpgrefifanldriirlviryftgn
    rtasrtvemmipvigldhpdaedivrnigsknismglakgiemlavnrklverirqtavk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z5hB (B:)
    mevekydltldfdiqkrtfngtetitadagdivldavglqinwmkvngrdtaftydgqtv
    rapgdsqpqkieisfagkvsdslsgiyyagrengmitthfeatdarrmfpcvdhpaykav
    faitvvidkdydaisnmppkrievserkvvefqdtprmstyllyvgigkfryeyekyrdi
    dlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgagamenwgaitf
    reiymdiaensavtvkrnsanviaheiahqwfgdlvtmkwwndlwlnesfatfmsyktmd
    tlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeisygkgasilrm
    iedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeywiknpgypvik
    lkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadglikinads
    agfyrvlyddatfsdvmghyrdlspldriglvddlfafllsghidpetyrqrirnffdde
    dhnvitaivgqmeylrmlthafdddarafcrsrmqfltgkqdenlkialgrvsrlyvmvd
    esyaeemsklfkdfdsaepemrssiatayalvtgdlkgllekfrsvdrdedrvriisafg
    klksntdlstvygmvekteikkqdmisffssaletlpgrefifanldriirlviryftgn
    rtasrtvemmipvigldhpdaedivrnigsknismglakgiemlavnrklverirqtavk