PDB entry 1z5g

View 1z5g on RCSB PDB site
Description: Crystal structure of Salmonella typhimurium AphA protein
Class: hydrolase
Keywords: Class-B bacterial non-specific acid phosphatases, AphA protein, metalloenzyme, HYDROLASE
Deposited on 2005-03-18, released 2006-03-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-09-02, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z5ga1
  • Chain 'B':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z5gb_
  • Chain 'C':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z5gc_
  • Chain 'D':
    Compound: AphA protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: aphA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1z5gd_
  • Heterogens: MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z5gA (A:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5gA (A:)
    tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
    pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
    tladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirgir
    ilraanstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z5gB (B:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5gB (B:)
    stlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkty
    spdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvs
    ktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirgi
    rilraanstykplpqagafgeevivnsey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z5gC (C:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5gC (C:)
    tlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkktys
    pdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetvsk
    tladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirgir
    ilraanstykplpqagafgeevivnsey
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z5gD (D:)
    lvsspstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwr
    gkktyspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtk
    tetvsktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardc
    girgirilraanstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z5gD (D:)
    pstlnpgtnvaklaeqapvhwvsvaqiensltgrppmavgfdiddtvlfsspgfwrgkkt
    yspdsddylknpafwekmnngwdefsipkeaarqlidmhvrrgdsiyfvtgrsqtktetv
    sktladnfhipaanmnpvifagdkpeqntkvqwlqeknmrifygdsdnditaardcgirg
    irilraanstykplpqagafgeevivnsey