PDB entry 1z5f

View 1z5f on RCSB PDB site
Description: Solution Structure of the Cytotoxic RC-RNase 3 with a Pyroglutamate Residue at the N-terminus
Class: Hydrolase
Keywords: ribonuclease, pyroglutamate, cytotoxicity, NMR, bullfrog, Hydrolase
Deposited on 2005-03-18, released 2006-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RC-RNase 3
  Species: Rana catesbeiana [TaxId:8400]
  Database cross-references and differences (RAF-indexed):
  • GB AAG31440 (0-104)
    • modified residue (0)
  Domains in SCOPe 2.06: d1z5fa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z5fA (A:)
  edwetfqkkhltdtkkvkcdvemakalfdckktntfiyalpgrvkalcknirdntdvlsr
  dafllpqcdriklpchyklssstnticitcvnqlpihfagvgscp