PDB entry 1z57

View 1z57 on RCSB PDB site
Description: Crystal structure of human CLK1 in complex with 10Z-Hymenialdisine
Deposited on 2005-03-17, released 2005-04-12
The last revision was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.14
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity protein kinase CLK1
    Species: Homo sapiens [TaxId:9606]
    Gene: clk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49759 (2-End)
      • cloning artifact (0-1)
  • Heterogens: DBQ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z57A (A:)
    smhlicqsgdvlsaryeivdtlgegafgkvvecidhkaggrhvavkivknvdryceaars
    eiqvlehlnttdpnstfrcvqmlewfehhghicivfellglstydfikengflpfrldhi
    rkmayqicksvnflhsnklthtdlkpenilfvqsdyteaynpkikrdertlinpdikvvd
    fgsatyddehhstlvstrhyrapevilalgwsqpcdvwsigcilieyylgftvfpthdsk
    ehlammerilgplpkhmiqktrkrkyfhhdrldwdehssagryvsrackplkefmlsqdv
    eherlfdliqkmleydpakritlrealkhpffdllkksi
    

    Sequence, based on observed residues (ATOM records):
    >1z57A (A:)
    smhlicqsgdvlsaryeivdtlgegafgkvvecidhkaggrhvavkivknvdryceaars
    eiqvlehlnttdpnstfrcvqmlewfehhghicivfellglstydfikengflpfrldhi
    rkmayqicksvnflhsnklthtdlkpenilfvqsdyteaynrdertlinpdikvvdfgsa
    tyddehhstlvstrhyrapevilalgwsqpcdvwsigcilieyylgftvfpthdskehla
    mmerilgplpkhmiqktrkrkyfhhdrldwdehssagryvsrackplkefmlsqdveher
    lfdliqkmleydpakritlrealkhpffdllkk