PDB entry 1z56

View 1z56 on RCSB PDB site
Description: co-crystal structure of lif1p-lig4p
Deposited on 2005-03-17, released 2006-01-31
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.92 Å
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ligase interacting factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ligase interacting factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA ligase IV
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DNL4, LIG4
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ligase interacting factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIF1
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z56 (0-7)
  • Chain 'E':
    Compound: Ligase interacting factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIF1
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z56
  • Chain 'F':
    Compound: Ligase interacting factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIF1
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z56 (0-44)
  • Chain 'G':
    Compound: Ligase interacting factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIF1
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z56 (0-36)
  • Chain 'H':
    Compound: Ligase interacting factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIF1
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z56 (0-6)
  • Chain 'I':
    Compound: Ligase interacting factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIF1
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z56 (0-29)
  • Chain 'J':
    Compound: Ligase interacting factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIF1
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z56 (0-19)
  • Chain 'K':
    Compound: Ligase interacting factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: LIF1
    Database cross-references and differences (RAF-indexed):
    • PDB 1Z56 (0-12)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1z56A (A:)
    msqltefiscipvvneeqneederglckiqiedgamletldenslsglriekmlvsegtg
    ifskssfgindlriftgenideeskkyvwyellkmltghkvyiasldekvvftkwtcrmq
    ddevwkvvmelessaiirkiaeltlhpvkkgeidlfemadklykdiccvndsyrnikesd
    ssnrnrveqlarerelldklletrdertrammvtllnekkkkirelheilrqnniklsdd
    dvldsa
    

    Sequence, based on observed residues (ATOM records):
    >1z56A (A:)
    adklykdiccvndsyrnikesdssnrnrveqlarerelldklletrdertrammvtllne
    kkkkirelheilrqnni
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1z56B (B:)
    msqltefiscipvvneeqneederglckiqiedgamletldenslsglriekmlvsegtg
    ifskssfgindlriftgenideeskkyvwyellkmltghkvyiasldekvvftkwtcrmq
    ddevwkvvmelessaiirkiaeltlhpvkkgeidlfemadklykdiccvndsyrnikesd
    ssnrnrveqlarerelldklletrdertrammvtllnekkkkirelheilrqnniklsdd
    dvldsa
    

    Sequence, based on observed residues (ATOM records):
    >1z56B (B:)
    femadklykdiccvndsyrnikesdssnrnrveqlarerelldklletrdertrammvtl
    lnekkkkirelheilr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1z56C (C:)
    pisnifagllfyvlsdyvtedtgiritraelektivehggkliynvilkrhsigdvrlis
    ckttteckalidrgydilhpnwvldciaykrliliepnycfnvsqkmravaekrvdclgd
    sfendisetklsslyksqlslppmgeleidsevrrfplflfsnriayvprrkisteddii
    emkiklfggkitdqqslcnliiipytdpilrkdcmnevhekikeqikasdtipkiarvva
    pewvdhsinencqvpeedfpvvny
    

    Sequence, based on observed residues (ATOM records):
    >1z56C (C:)
    snifagllfyvlsdyvtedtgiritraelektivehggkliynvilkrhsigdvrlisck
    ttteckalidrgydilhpnwvldciaykrliliepnycfnvsqkmravaekrvdclgdsf
    endisetklsslyksqlslppmgeleidsevrrfplfiemkiklfggkitdqqslcnlii
    ipytdpilrkdcmnevhekikeqikasdtipkiarvvapewvdhsinencqvpeedf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1z56D (D:)
    xxxxxxxx
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1z56E (E:)
    xxxxxxx
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >1z56F (F:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >1z56G (G:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1z56H (H:)
    xxxxxxx
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1z56I (I:)
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >1z56J (J:)
    xxxxxxxxxxxxxxxxxxxx
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >1z56K (K:)
    xxxxxxxxxxxxx