PDB entry 1z54

View 1z54 on RCSB PDB site
Description: Crystal structure of a hypothetical protein TT1821 from Thermus thermophilus
Class: hydrolase
Keywords: Hypothetical protein, Thermus thermophilus, Structural Genomics, NPPSFA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, National Project on Protein Structural and Functional Analyses, HYDROLASE, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2005-03-17, released 2005-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable thioesterase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z54a1
  • Chain 'B':
    Compound: probable thioesterase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z54b_
  • Chain 'C':
    Compound: probable thioesterase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z54c_
  • Chain 'D':
    Compound: probable thioesterase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z54d_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z54A (A:)
    mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
    ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraaripe
    diyralsvlhlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z54B (B:)
    mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
    ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraaripe
    diyralsvlhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z54B (B:)
    mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
    ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqveraariped
    iyralsvlhlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z54C (C:)
    mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
    ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraaripe
    diyralsvlhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z54C (C:)
    esvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelgl
    tfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraariped
    iyralsvlh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z54D (D:)
    mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
    ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraaripe
    diyralsvlhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z54D (D:)
    mesvtrikvryaetdqmgvvhhsvyavyleaarvdfleraglpyhrveargvffpvvelg
    ltfraparfgevvevrtrlaelssrallfryrveregvllaegftrhlcqvgeraaripe
    diyralsvlh