PDB entry 1z53

View 1z53 on RCSB PDB site
Description: The 1.13 Angstrom Structure of Iron-free Cytochrome c Peroxidase
Class: oxidoreductase
Keywords: CcP, Heme peroxidase, Iron-free protoporphyrin IX, Trp cation radical, OXIDOREDUCTASE
Deposited on 2005-03-17, released 2005-06-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: 0.134
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1z53a_
  • Heterogens: PP9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z53A (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z53A (A:)
    tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
    ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
    pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
    lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
    pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl