PDB entry 1z4u

View 1z4u on RCSB PDB site
Description: hepatitis C virus NS5B RNA-dependent RNA polymerase complex with inhibitor PHA-00799585
Class: transferase
Keywords: NS5B, polymerase, HCV, fingers, palm, thumb, TRANSFERASE
Deposited on 2005-03-16, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hcv ns5b polymerase
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z4ua_
  • Heterogens: CL, PO4, PH9, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z4uA (A:)
    msmsytwtgalitpcaaeesklpinalsnsllrhhnlvysttsrsaslrqkkvtfdrlqv
    lddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrslssravnhi
    rsvwkdlledtdtpiqttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvv
    stlpqavmgssygfqyspkqrveflvntwkakkcpmgfsydtrcfdstvtendirveesi
    yqccdlapearqairslterlyvggpmtnskgqncgyrrcrasgvlttscgntltcylka
    aaacraaklqdctmlvngddlvvicesagtqedaaslrvfteamtrysappgdppqpeyd
    lelitscssnvsvahdasgkrvyyltrdptvplaraawetarhtpvnswlgniimyaptl
    warmilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsysp
    geinrvasclrklgvpplrvwrhrarsvrakllsqggraaicgkylfnwavrtklkltpi
    paasrlllsgwfvagysggdiyhslsrarprhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4uA (A:)
    msmsytwtgalitpcaaeesklpinalsnsllrhhnlvysttsrsaslrqkkvtfdrlqv
    lddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrslssravnhi
    rsvwkdlledtdtpiqttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvv
    stlpqavmgssygfqyspkqrveflvntwkakkcpmgfsydtrcfdstvtendirveesi
    yqccdlapearqairslterlyvggpmtnskgqncgyrrcrasgvlttscgntltcylka
    aaacraaklqdctmlvngddlvvicesagtqedaaslrvfteamtrysappgdppqpeyd
    lelitscssnvsvahdasgkrvyyltrdptvplaraawetarhtpvnswlgniimyaptl
    warmilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsysp
    geinrvasclrklgvpplrvwrhrarsvrakllsqggraaicgkylfnwavrtklkltpi
    paasrlllsgwfvagysggdiyhs