PDB entry 1z4s

View 1z4s on RCSB PDB site
Description: Crystal Structure of Gly19 and Glu60 deletion mutant of Human Acidic Fibroblast Growth Factor
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2005-03-16, released 2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z4sa1, d1z4sa2
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z4sb1, d1z4sb2
  • Chain 'C':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z4sc1, d1z4sc2
  • Chain 'D':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z4sd1, d1z4sd2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z4sA (A:)
    hhhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    iksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    ckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4sA (A:)
    hhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyiks
    ttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckr
    gprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z4sB (B:)
    hhhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    iksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    ckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4sB (B:)
    hhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    ksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
    krgprthygqkailflplpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1z4sC (C:)
    hhhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    iksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    ckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4sC (C:)
    hhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    ksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsc
    krgprthygqkailflplpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1z4sD (D:)
    hhhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    iksttgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    ckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4sD (D:)
    hhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikst
    tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
    prthygqkailflplpv