PDB entry 1z4r

View 1z4r on RCSB PDB site
Description: Human GCN5 Acetyltransferase
Class: transferase
Keywords: GCN5, Acetyltransferase, SGC, Structural Genomics, Structural Genomics Consortium
Deposited on 2005-03-16, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-05-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.197
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General control of amino acid synthesis protein 5-like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GCN5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92830 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d1z4ra1, d1z4ra2
  • Heterogens: ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z4rA (A:)
    gsgiiefhvignsltpkanrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlali
    kdgrviggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltya
    deyaigyfkkqgfskdikvpksrylgyikdyegatlmecelnpripyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4rA (A:)
    sgiiefhvignsltpkanrrvllwlvglqnvfshqlprmpkeyiarlvfdpkhktlalik
    dgrviggicfrmfptqgfteivfcavtsneqvkgygthlmnhlkeyhikhnilyfltyad
    eyaigyfkkqgfskdikvpksrylgyikdyegatlmecelnpr