PDB entry 1z4q

View 1z4q on RCSB PDB site
Description: Structure of the D41N variant of the human mitochondrial deoxyribonucleotidase in complex with 2',3'-dideoxy-2',3-didehydrothymidine 5'-monophosphate (d4T-MP)
Class: Hydrolase
Keywords: alfa beta fold, Hydrolase
Deposited on 2005-03-16, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.176
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'(3')-deoxyribonucleotidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPB1
      • engineered (9)
    Domains in SCOPe 2.07: d1z4qa_
  • Heterogens: MG, D4M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z4qA (A:)
    ggralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsek
    aisiwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyf
    gpdfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrl
    hswaddwkaildskrpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z4qA (A:)
    ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
    siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
    dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
    waddwkaildskrp